Protein Info for Dsui_2810 in Dechlorosoma suillum PS

Annotation: ABC-type transport system involved in resistance to organic solvents, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 28 (22 residues), see Phobius details PF02470: MlaD" amino acids 39 to 113 (75 residues), 51 bits, see alignment E=7.3e-18

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 53% identity to app:CAP2UW1_1067)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFN6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Dsui_2810 ABC-type transport system involved in resistance to organic solvents, periplasmic component (Dechlorosoma suillum PS)
MENRAHALVAGLFTLLLAAAVLFSVWWFGGKHDVTRDYLVVTQGNVTGLNLQAQVRYRGI
RVGRVEDIRLDKNQPDDILIRISILDEVPVTRSTVALLNYQGVTGLAQVQLEERGDDDRP
LAAGDGLPRIPMQPSLIQELSDAGAETLRQARELLTSANQLVGEENQRRVGNTLANLESI
SAGLKPAAQELGPTLVQLRKALADDNLKHLSSALEGSAGTAREAKELVAGLRRLSERLEQ
SGGGESGAGLLSPRWGDLAGDIAASTRQLNRVLNQVERDPQSLIFGAPAPVPGPGEPGFL
PHPGRNP