Protein Info for Dsui_2805 in Dechlorosoma suillum PS

Annotation: EamA-like transporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details transmembrane" amino acids 7 to 21 (15 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 56 to 73 (18 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 235 to 254 (20 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details PF00892: EamA" amino acids 3 to 127 (125 residues), 35.9 bits, see alignment E=4.3e-13 amino acids 138 to 276 (139 residues), 31.4 bits, see alignment E=1.1e-11

Best Hits

Swiss-Prot: 67% identical to BIOP_PSEAE: Probable biotin transporter (PA3474) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 82% identity to pfv:Psefu_0138)

MetaCyc: 47% identical to biotin transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-240

Predicted SEED Role

"MadN protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFN1 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Dsui_2805 EamA-like transporter family (Dechlorosoma suillum PS)
MPYLITVNLLWAFSFSLIGEYLAGRVDSDFAVLVRVAIAALVFIPFTRWRGLPGRLVVGL
WLAGALQFGVTYLCLYRSFTVLTVPEVLLFTVLTPIYVTMLDDALARRFNPWALVAALVA
VGGGVVIRFQPVAGEYLAGFLLLQLANATFAAGQVLCRHLLARYPLQFPLSRCFGHFFLG
ALVLALPSFLIFGNPARLPTTAVQWGVLLWMGLFATALGMFWWVKGSTRVDGGTLAVMNE
LHVPLGLVVNLLIWNRDADLQRIALGGSVILVSLWLNRWGRRRFVAAAA