Protein Info for Dsui_2800 in Dechlorosoma suillum PS

Annotation: ABC-type dipeptide/oligopeptide/nickel transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 298 to 321 (24 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 416 to 420 (5 residues), see Phobius details amino acids 447 to 470 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 278 to 481 (204 residues), 86.9 bits, see alignment E=7.5e-29

Best Hits

Predicted SEED Role

"Oligopeptide transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFM6 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Dsui_2800 ABC-type dipeptide/oligopeptide/nickel transport system, permease component (Dechlorosoma suillum PS)
MAFLPVFLWSDLVIWLLVAALGLLAWGVARTPPLRAAWGRVLHSRTGMASLAVLALFVAV
GLLDSAHYRPRLADAPQNGQGGGVAAAPAYGVEVLSLLDALLTPLRTQVEKTYSAPLATR
AYAKEMQEVRQPDGSLVQQRDFPRLKFGGAHLGTEESAWAGDVARRLLQGYGLAALLWGG
LAIFLVGRLARRRQCSFRQSWRDLWWRPPTSTAPAWDALLLTLAGLFLLLTPLLALAPEY
HVLGTDKVGQDILYLVLKSIRTSLVIGLVTTLVTLPIGVLLGISAGYFRGWVDDLIQYLY
STLNSIPSVLLIAAAVLMMQVVIDTHPEWFATAAERADLRLLALCFILGMTSWTGLARLL
RGEALKLSQLEYIQAAQSFGVSSWRILLRHILPNVMHIVLIALVMDFSSLVMTEAVLSYL
EIGVDPTMVSFGSLINNARMELAREPMVWWSLAAAFVFMFILVLAANLFADVVRDAFDPR
AA