Protein Info for Dsui_2778 in Dechlorosoma suillum PS

Annotation: isoleucine patch superfamily enzyme, carbonic anhydrase/acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00132: Hexapep" amino acids 88 to 121 (34 residues), 32.1 bits, see alignment 3.2e-12

Best Hits

Swiss-Prot: 61% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 79% identity to dar:Daro_2740)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QQ17 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Dsui_2778 isoleucine patch superfamily enzyme, carbonic anhydrase/acetyltransferase (Dechlorosoma suillum PS)
MPIYKIDQKTPQIAASAWVAPNATVIGDARLGDNVSIWWNAVLRGDNDPIHIGANSNIQD
GSVLHTDEGVPMHIGANVTVGHMVMLHGCTVGDNSLIGIGSVILNRAVIGKHSIVGANTL
IPEGKVFPDGVLIVGSPGKVVRELSEEEKARLQKSADHYVDNARRYASRLVEL