Protein Info for Dsui_2763 in Dechlorosoma suillum PS

Annotation: ribosome biogenesis GTP-binding protein YlqF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 TIGR03596: ribosome biogenesis GTP-binding protein YlqF" amino acids 3 to 276 (274 residues), 315.2 bits, see alignment E=3.9e-98 PF01926: MMR_HSR1" amino acids 119 to 177 (59 residues), 55.6 bits, see alignment E=5.5e-19 PF02421: FeoB_N" amino acids 119 to 171 (53 residues), 28.1 bits, see alignment 1.4e-10

Best Hits

KEGG orthology group: K14540, ribosome biogenesis GTPase A (inferred from 70% identity to tbd:Tbd_2120)

Predicted SEED Role

"50S ribosomal subunit maturation GTPase RbgA (B. subtilis YlqF)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QQ03 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Dsui_2763 ribosome biogenesis GTP-binding protein YlqF (Dechlorosoma suillum PS)
MTIQWFPGHMTSARKKAAETMEFADVVIEVLDARLPEASRNPMIEELRKHRQRPCLKLLN
KSDLADPAVTQAWLDYYKQQPDVKAVAISCKKPGEVARIPALAQTLAPHRNSNVKPLRLM
IMGIPNVGKSTLLNALVKRKVAAVGDQPAVTKQQQRMDLGPRLSIVDTPGLMWPKIELAS
DGLMLAASHAVGPNAYIDEEVGVYLAELLLQRYPQCLEARYGLKAAETDAVGVVETVARK
RGCIIKGRAGELDLEKASLILLNDYRNGTLGRISLETPESRAALLQAAAAGQLVPPEEAP
GADE