Protein Info for Dsui_2752 in Dechlorosoma suillum PS

Annotation: ABC-type multidrug transport system, ATPase and permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 735 transmembrane" amino acids 163 to 184 (22 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 277 to 302 (26 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 421 to 438 (18 residues), see Phobius details PF00664: ABC_membrane" amino acids 163 to 436 (274 residues), 158.4 bits, see alignment E=3e-50 PF00005: ABC_tran" amino acids 501 to 650 (150 residues), 114.9 bits, see alignment E=4.5e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 73% identity to reu:Reut_A2584)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPZ2 at UniProt or InterPro

Protein Sequence (735 amino acids)

>Dsui_2752 ABC-type multidrug transport system, ATPase and permease component (Dechlorosoma suillum PS)
MSALLGPDETILAHLELDLDKTLRFARGLVLVTDRQLIARSGEEPAWQAFPYRAGLHLQR
RDHAGVASLELVDEQRQLARWRHTLGKDTNARQVLDHFEQQRDAAVSGQPVEAPPAAICA
RCGAPLVPGQDDCPSCAKELYTPPSTWTLFRLWRFARPYRGQLLAGFILTLISTAATLVA
PYMTMPLMDEVLIPYQNGQPLDTGKVYFYLGGLLGSALLAWGLGWAKTYILALVSERLGA
DLRSQTYEHLLKLSLEYFGGKRTGDLMARIGSESDRICVFLSLYLLDFFTDVLMITMTAV
ILVSINPWLAAVTLIPLPFIVWLIHVVRDKLRHGFEQIDRVWSGVTSVLADTIPGIRVVK
AFAQEKRETSRFKDANQRNLEANDRVNRLWSLFSPTITLLTEVGLLIVWGLGIWLVTKNQ
VTVGTLAAFLAYIGRFYTRLDSMSRIVSHTQKAASGAKRIFDILDHVSSVPEPVKPQHLT
KVEGGITVERVGFRYGNRTVLRGVDLKINPGEMIGLVGHSGSGKSTLVNLICRFYDVGEG
AICIDGVDVRNIPVSEYRKHIGLVLQEPFLFFGTIAENIAYGKPDASREEIVAAARAAHA
HEFILRLPHGYDSLVGERGQALSGGERQRISIARALLIDPKILILDEATSAVDTETELEI
QGALDNLIKGRTTIAIAHRLSTLRKADRLVVMDRGVVVEEGQHDELIAKEGAYYRLYTAQ
TKQLDEQLAERESEE