Protein Info for Dsui_2749 in Dechlorosoma suillum PS

Annotation: putative acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 239 to 255 (17 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 9 to 344 (336 residues), 73.5 bits, see alignment E=8.6e-25

Best Hits

KEGG orthology group: None (inferred from 60% identity to rme:Rmet_4573)

Predicted SEED Role

"Acyltransferase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPY9 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Dsui_2749 putative acyltransferase (Dechlorosoma suillum PS)
MSSGPSRLVFIDVLKAFASQLIVLHHLAFYGPMSDAAQELVPGLIGWLSEYARIAVQVFL
VVGGFLAIRALAPQGQLLTRQPVNMLARRYLRLVPPFLAAMAIAVVCAHVARLWMDHDSI
PDKPMALQVLAHAFLLHNILDFDALSAGVWYIAIDFQLFALLVGLLWLGRWGRERIPAMA
GGRSRGVHSLGMILVFSLVLASLFHFNRDASWDVWAVYFFGAYGMGVMAYWASERGQSPV
WLAIIASVALVALFLDFRLRIAVALCAALALGLARRSGWMERWPLGLPGQTAITFLSRVS
YSVFLVHFPVCLLVNGAFDRFVPAEPALQLTGMVLAWLGSIVAGTAFHFYVESRQWNLSG
MLQTLWRRTAKA