Protein Info for Dsui_2741 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 transmembrane" amino acids 95 to 116 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 68 to 176 (109 residues), 46.3 bits, see alignment E=2.1e-16 PF13188: PAS_8" amino acids 69 to 120 (52 residues), 26.1 bits, see alignment E=8.8e-10 PF00989: PAS" amino acids 71 to 176 (106 residues), 41.1 bits, see alignment E=2.4e-14 PF08448: PAS_4" amino acids 74 to 179 (106 residues), 41.7 bits, see alignment E=1.8e-14

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPY1 at UniProt or InterPro

Protein Sequence (188 amino acids)

>Dsui_2741 PAS domain S-box (Dechlorosoma suillum PS)
MSAPLLPHSLYRIELCSGEQRRWRYRGEDAQGNRWWRDEESGQEFNEASLMYAWQVLGPA
PDDLPASIHRLLAEQMDAALILADKEGVIRLWNGAATALFGFPAAAAIGASLDLIIPEHL
RAAHWRGFHQAMARGAVQHPGKPRLTRALQVDGQKRYVSMSFSVIQDDTGQTIGSLALAW
AADKPAGA