Protein Info for Dsui_2723 in Dechlorosoma suillum PS

Annotation: transcription termination factor NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 PF08529: NusA_N" amino acids 4 to 126 (123 residues), 135.6 bits, see alignment E=3e-43 TIGR01953: transcription termination factor NusA" amino acids 5 to 343 (339 residues), 420.2 bits, see alignment E=5.5e-130 PF00575: S1" amino acids 136 to 195 (60 residues), 32 bits, see alignment E=4e-11 PF13184: KH_NusA_1st" amino acids 200 to 277 (78 residues), 108.1 bits, see alignment E=6.3e-35 PF26594: KH_NusA_2nd" amino acids 281 to 346 (66 residues), 80.2 bits, see alignment E=2.3e-26 PF07650: KH_2" amino acids 291 to 332 (42 residues), 22.4 bits, see alignment 2.7e-08 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 366 to 414 (49 residues), 67.2 bits, see alignment 1e-22 amino acids 439 to 488 (50 residues), 60.2 bits, see alignment 1.5e-20 PF14520: HHH_5" amino acids 432 to 485 (54 residues), 44.8 bits, see alignment 4.4e-15

Best Hits

Swiss-Prot: 53% identical to NUSA_COXBU: Transcription termination/antitermination protein NusA (nusA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 82% identity to dar:Daro_2453)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPW3 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Dsui_2723 transcription termination factor NusA (Dechlorosoma suillum PS)
MSREILLLVDALAREKNVAKDVVFGALESALASATKKRINDEADVRVVIDRNTGEYESFR
RWQVVADETYVNEFLEMPLSEAQKQDEGVEVGDVIEESLEPIDFGRIGAQAAKQVILQRI
RDAEREQILADFLERKEHIVSGTIKRMERGNAIIEAGKIEALLPRDQMIPKENLRVGDRV
KAFLLRIDRNARGPQIILSRTAPEFIIKLFDLEVPEIEDGLMEIKAAARDPGMRAKIAVK
SNDPRVDPIGTCVGMRGTRVTAVTNELAGERVDIVHWSQDPAQFVIGALAPAEVSSIVVD
EEKHSMDVVVDEANLAIAIGRGGQNVRLASELTGWNINLMTQEESEKKVEAETAATRVLF
MEKLDVDEEVANILIDEGFSTLEEVAYVPLAEMLEIEAFDEDTVNELRNRARNVLLTEAI
VTEEQLEGVEDSLLALDGMDKSLAAKLASGGVKTLDDLADLAVDELTEITGIDADRAKQL
ITNARSHWFE