Protein Info for Dsui_2722 in Dechlorosoma suillum PS

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 930 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 34.9 bits, see alignment 4.2e-12 amino acids 353 to 404 (52 residues), 57.8 bits, see alignment 3e-19 PF08364: IF2_assoc" amino acids 60 to 98 (39 residues), 54.2 bits, see alignment (E = 5.6e-18) TIGR00487: translation initiation factor IF-2" amino acids 348 to 929 (582 residues), 864.9 bits, see alignment E=3.4e-264 TIGR00231: small GTP-binding protein domain" amino acids 434 to 589 (156 residues), 109.2 bits, see alignment E=1.8e-35 PF00009: GTP_EFTU" amino acids 434 to 590 (157 residues), 128.9 bits, see alignment E=7e-41 PF01926: MMR_HSR1" amino acids 435 to 540 (106 residues), 39.9 bits, see alignment E=1.7e-13 PF00071: Ras" amino acids 436 to 591 (156 residues), 22.9 bits, see alignment E=2.3e-08 PF22042: EF-G_D2" amino acids 605 to 684 (80 residues), 101 bits, see alignment E=1.3e-32 PF11987: IF-2" amino acids 706 to 820 (115 residues), 145.4 bits, see alignment E=2.9e-46

Best Hits

Swiss-Prot: 69% identical to IF2_AZOSB: Translation initiation factor IF-2 (infB) from Azoarcus sp. (strain BH72)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 69% identity to app:CAP2UW1_2967)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPG8 at UniProt or InterPro

Protein Sequence (930 amino acids)

>Dsui_2722 translation initiation factor IF-2 (Dechlorosoma suillum PS)
MAQTTVSQFAAELKMPAAVLLEQLQKAGVSKQAAEDQLSEQDKTRLLDYLRSSHGEAQGK
NKITLTRKQTSEIKAQDSTGKTRTVQVEVRKKRVLVKREAGEGVVEAAVEEAQQAAVQAE
PVVEPVAAPVVEAAPEPVPEPVVEVAPEPAPEPVPEPVVEAAPEPVAAPAEEPVAAAEPA
PAAAPTRTKVVKRSMVSVIGEAEMKAREEEARRHQALLEHQQREYQEKQARAAELVRLRR
EAEEKAVALKAAEAAKKAATAHQVAQPADDKPADRTLHKPAGKPGDAKPGAKKEGGWNDG
NKKRPGLKTRGGDANSGWRSGGGKHGKRHGGGNDEAHAFQAPTEPIVREVHVPETISVAD
LAHKMAVKATEVIKTLMKMGSMVTINQVLDQETAMIVVEEMGHKALAAKLDDPDAFLDDA
VEHVDVKQEPRAPVVTVMGHVDHGKTSLLDYIRRTRVASGEAGGITQHIGAYHVETPRGM
VTFLDTPGHEAFTAMRARGAKATDLVILVVAADDGVMPQTKEAIHHAKAANVPLVVAVNK
IDKPEANPDRVKQELIAEGVVPEEYGGDSPFVPVSAKKGTGIDDLLEHVLLQAEVLELTA
PKDAPAKGIIIEARLDKGKGPVATILVQSGTLKRGDIVLVGQVFGKVRAMLDENGKPIDQ
AGPSIPVEIQGLSDVPAAGEEAMVLADERKAREIALFRQGKFREVKLAKQQAAKLESMFD
NMGEGAAKFLPLIVKSDVQGSQEALVQSLNKLSTDEVRVNVIHAAVGAITETDVNLASAS
KAVIIGFNTRADAGARKAADTFGVDIRYYNIIYDAVDEVKAALSGMLSPEKREQITGLVE
IRQVFRISKVGSIAGCLVLEGVVKRNSRVRLLRNNVVQWDGELDSLKRYKDDVKEVKGGF
ECGLSLKNFNEIEEGDQLEVYEIQEIARSL