Protein Info for Dsui_2711 in Dechlorosoma suillum PS

Annotation: succinyl-diaminopimelate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 13 to 381 (369 residues), 538 bits, see alignment E=5.7e-166 PF01546: Peptidase_M20" amino acids 70 to 380 (311 residues), 156 bits, see alignment E=1.3e-49 PF07687: M20_dimer" amino acids 183 to 290 (108 residues), 102.8 bits, see alignment E=1e-33

Best Hits

Swiss-Prot: 73% identical to DAPE_DECAR: Succinyl-diaminopimelate desuccinylase (dapE) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 73% identity to dar:Daro_1724)

MetaCyc: 57% identical to succinyl-diaminopimelate desuccinylase (Escherichia coli K-12 substr. MG1655)
Succinyl-diaminopimelate desuccinylase. [EC: 3.5.1.18]

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPG0 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Dsui_2711 succinyl-diaminopimelate desuccinylase (Dechlorosoma suillum PS)
MSQPISCTSDPTLDLAAQLISRRSVTPEDGGCMDLISARLKPLGFTLEAINQGNTVNLWA
RRGSAAPLVCLAGHTDVVPTGPVEQWASDPFTPTLRDGMLYGRGAADMKGSLAAFVTAVE
TFVARHPQHQGSIAFLLTSDEEGDATDGTVAVVEALQARGEGIDCCIVGEPTCVNRLGDM
VKNGRRGSLSGRLTVKGIQGHIAYPHLAKNPIHLAAPAIAELAATEWDQGNEYFPPTTWQ
VSNIRGGTGATNVIPGTVDILFNFRFSTASTPEGLKSRLEAVLAKHGIDYDLAWTLGAKP
FLTGRGPLVDAAMAAIREELNIETELSTTGGTSDGRFIAEICPQVIELGPVNATIHKIDE
CVEAAALPRLSATYCRILEKLLT