Protein Info for Dsui_2699 in Dechlorosoma suillum PS

Annotation: hypoxanthine-guanine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details PF00156: Pribosyltran" amino acids 21 to 165 (145 residues), 81.5 bits, see alignment E=2.2e-27

Best Hits

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 67% identity to dar:Daro_1736)

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPE8 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Dsui_2699 hypoxanthine-guanine phosphoribosyltransferase (Dechlorosoma suillum PS)
MATREEALALLARGELVHSAETVSAAVDRVAAEITARLGESNPLILCVMTGGVVFAGQLM
ARLPFPADFDYLHATRYGQDTAGGALSWRAAPWTSVKDRTVLVVDDILDEGVTLAAIKDR
LLHQGAKAVYLAVATDKENGKNKPVTADFAALKVPDRFVFGYGMDAYGAWRNLPAIYALK
DE