Protein Info for Dsui_2695 in Dechlorosoma suillum PS

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 TIGR00500: methionine aminopeptidase, type I" amino acids 4 to 253 (250 residues), 334.5 bits, see alignment E=2e-104 PF00557: Peptidase_M24" amino acids 12 to 246 (235 residues), 188.6 bits, see alignment E=6.5e-60

Best Hits

Swiss-Prot: 64% identical to MAP1_SALTI: Methionine aminopeptidase (map) from Salmonella typhi

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 81% identity to dar:Daro_1740)

MetaCyc: 63% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPE4 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Dsui_2695 methionine aminopeptidase, type I (Dechlorosoma suillum PS)
MSVIIKTADEIEKMRIACRLAAEVLDHVTPYVKPGVTTGELDRICHDYMVNVQGCIPAPL
NYAPPGYTPYPKSICTSINHQVCHGIPGEKPLKNGDIVNLDITVIKDGFHGDTSRMFVVG
EGSILAKRLCEITHDCMWIGINQIKPGAHLGDIGAAIQKYAENAGFSVVREFCGHGIGRK
FHEDPQVLHYGKAGTGIELKPGMIFTVEPMINAGKAAIKEMGDGWTIVTKDRSLSAQWEH
TILVTETGYEALTVSAGSRPKPDWI