Protein Info for Dsui_2686 in Dechlorosoma suillum PS

Annotation: outer membrane protein assembly complex, YaeT protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03303: outer membrane protein assembly complex, YaeT protein" amino acids 24 to 764 (741 residues), 906.1 bits, see alignment E=9.5e-277 PF07244: POTRA" amino acids 25 to 83 (59 residues), 24.2 bits, see alignment 9.2e-09 amino acids 93 to 172 (80 residues), 53.6 bits, see alignment E=6.3e-18 amino acids 176 to 263 (88 residues), 74.8 bits, see alignment E=1.5e-24 amino acids 267 to 344 (78 residues), 58.9 bits, see alignment E=1.3e-19 amino acids 347 to 421 (75 residues), 61 bits, see alignment E=3e-20 PF01103: Omp85" amino acids 448 to 764 (317 residues), 264 bits, see alignment E=5e-82

Best Hits

Swiss-Prot: 42% identical to BAMA_NEIMB: Outer membrane protein assembly factor BamA (bamA) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K07277, outer membrane protein (inferred from 66% identity to dar:Daro_1750)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPD5 at UniProt or InterPro

Protein Sequence (764 amino acids)

>Dsui_2686 outer membrane protein assembly complex, YaeT protein (Dechlorosoma suillum PS)
MNKNLLAGVVAALFASAAQAFDPFVVKDIRVEGIQRTEAGTVFSYLPVRVGDTLNDERAA
QAIKALFATGFFKDVRIEVDGDVMVLVLEERPAISQIDFVGLKEFDKDQLKKGLKDVGLA
ESRIFDRALLDKAEQELKRQYLSRGKYAVEIKTTVTPLERNRVAINFTIDEGDAAKIKQI
NIVGNQAFKEKELLELFQLQTPGWLTWYTKNDQYSKQKLSADLESLKSYYQNRGYLEFNV
ESTQVSISPDKKDIYITISVNEGERFIVSSVKLAGDLIAPEAELRKLVTIKPGEIFSREK
LNETQKAVSDRLGREGYAFANVNSAPEVDKEKRQVAFTIFVDPGKRVYVRRINIGGNTRT
RDEVIRQEMRQMEGGWYDAEKIQLSKQRVDKLGYFSDVTVETPPVAGTSDQVDVSMNVTE
KPTGNLMLGAGFSSNDGVILSGSIAQQNVFGSGKSVSVGVNTAKSRETYSLSYTNPYFTV
DGISQGFDVYKKTYDPTNSSYYAKSYKTTSIGGGLRWGIPIAEKETFSFGVAVDNTDITT
LSTSRQIYLDHVKEFGNSNTSVSGTVGWSQDGRDSLIYPTKGGMTRVSAEVAPAGSLKYY
KMNLQHQRFFPFTKDLVLMLNGELGIGNGLNGKSLPFYRSYYAGGVTSVRGYDVASLGPR
QNDEAIGGTKRVVMNAELLFPMPGTGLDKSLRLGWFVDAGQVFGPKDDNGDYSKFALGDL
RYSTGLAVAWASPMGPLKFSVAQPLNDKEGDKTQRFQFTMGTTF