Protein Info for Dsui_2684 in Dechlorosoma suillum PS

Annotation: UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 10 to 313 (304 residues), 326.4 bits, see alignment E=8.4e-102 PF04613: LpxD" amino acids 25 to 91 (67 residues), 76.4 bits, see alignment E=1.9e-25 PF00132: Hexapep" amino acids 106 to 138 (33 residues), 33.5 bits, see alignment 3.5e-12 amino acids 129 to 163 (35 residues), 36.4 bits, see alignment 4.1e-13 PF14602: Hexapep_2" amino acids 113 to 146 (34 residues), 13 bits, see alignment 1.1e-05 amino acids 185 to 217 (33 residues), 15.4 bits, see alignment 2e-06 amino acids 244 to 275 (32 residues), 18.4 bits, see alignment 2.2e-07

Best Hits

Swiss-Prot: 59% identical to LPXD_AROAE: UDP-3-O-acylglucosamine N-acyltransferase (lpxD) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 59% identity to eba:ebA5998)

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.191)" (EC 2.3.1.191)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPD3 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dsui_2684 UDP-3-O-(3-hydroxymyristoyl) glucosamine N-acyltransferase (Dechlorosoma suillum PS)
MTGEGIRLDEIVARLGGSLLGDGAVQICGVGTLAGAGEGQISFLSNPKYRSQLASTRAAA
VIVPPAMQDGTDRPRIVAANSYTYYARVAQLLYPARQPKTPVHPSVVLGQDVQLGEGVVI
HAGCVIGDGASIGDGSVLHPNVTVYAGCRIGKRALIHAGAVIGADGFGFAKDGEAWLKIP
QVGRVIIGDDVEIGANTTIDRGAIEDTVIGDGVKLDNQIQVGHNVVIGDHAAMAGCVGIA
GSARIGRRCTVGGGAIILGHLELGDDVHVSSGTLVAKSLKQPGQYTGAFPVERHEGWLKN
AAHLRHLSKLADRVHELEKKLSELEKKS