Protein Info for Dsui_2682 in Dechlorosoma suillum PS

Annotation: acyl-(acyl-carrier-protein)--UDP-N- acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to LPXA_THIDA: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Thiobacillus denitrificans (strain ATCC 25259)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 77% identity to app:CAP2UW1_2865)

MetaCyc: 56% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
lipid IV_A biosynthesis (E. coli) (6/6 steps found)
lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
lipid IV_A biosynthesis (P. putida) (6/6 steps found)
lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
lipid IV_A biosynthesis (generic) (6/6 steps found)
superpathway of Kdo₂-lipid A biosynthesis (15/25 steps found)

KEGG Metabolic Maps

Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPD1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Dsui_2682 acyl-(acyl-carrier-protein)--UDP-N- acetylglucosamine O-acyltransferase (Dechlorosoma suillum PS)
MIHQTAIVHPGARLGANVSVGAYSIIGEHVQIGDNTEIGPHVVIEGHTTIGRDNRIFQFC
SIGAEPQDKKYAGEPTRLEIGDRNVIREFCTFNLGTIQDGGVTRLGNDNWIMAYVHLAHD
CQVGNHTIFANNAQLAGHCHVDDHAILGGFTVVHQFVRIGAHSMTGMGTILFQDLPPYVT
AAGNTASPYGINSEGLKRRGFSSEAVMALKRAYRAIYKSGLTLEEAKAKLEADLAKHPEY
QLLLDFLAVSKRGIVR