Protein Info for Dsui_2675 in Dechlorosoma suillum PS

Annotation: SsrA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 TIGR00086: SsrA-binding protein" amino acids 3 to 144 (142 residues), 187.2 bits, see alignment E=8.2e-60 PF01668: SmpB" amino acids 3 to 145 (143 residues), 199.4 bits, see alignment E=1.3e-63

Best Hits

Swiss-Prot: 73% identical to SSRP_THIDA: SsrA-binding protein (smpB) from Thiobacillus denitrificans (strain ATCC 25259)

KEGG orthology group: K03664, SsrA-binding protein (inferred from 73% identity to tbd:Tbd_1756)

Predicted SEED Role

"tmRNA-binding protein SmpB" in subsystem Heat shock dnaK gene cluster extended or Staphylococcal pathogenicity islands SaPI or Trans-translation by stalled ribosomes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPC4 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Dsui_2675 SsrA-binding protein (Dechlorosoma suillum PS)
MSITTNKKAFHDYFVEEKIEAGLALEGWEVKAIRAGRVNLKESYVVIKNGEIWLLGMHLT
PLYTASTHVHPEATRTRKLLLHREQIDKLIGKVERAGFTLVPLDLHYTRGRVKVEVGLAK
GKKMHDKRETEKQRDWDREKQRLMRVKV