Protein Info for Dsui_2670 in Dechlorosoma suillum PS

Annotation: GMP synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 6 to 204 (199 residues), 235.1 bits, see alignment E=4.1e-74 PF00117: GATase" amino acids 7 to 199 (193 residues), 143 bits, see alignment E=2.4e-45 PF07722: Peptidase_C26" amino acids 72 to 183 (112 residues), 42.3 bits, see alignment E=1.9e-14 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 213 to 544 (332 residues), 463.4 bits, see alignment E=3.7e-143 PF02540: NAD_synthase" amino acids 223 to 289 (67 residues), 30.9 bits, see alignment E=3.9e-11 PF03054: tRNA_Me_trans" amino acids 229 to 261 (33 residues), 20.9 bits, see alignment (E = 6.2e-08) PF00958: GMP_synt_C" amino acids 458 to 543 (86 residues), 137.3 bits, see alignment E=3.7e-44

Best Hits

Swiss-Prot: 94% identical to GUAA_DECAR: GMP synthase [glutamine-hydrolyzing] (guaA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 94% identity to dar:Daro_2337)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPB9 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Dsui_2670 GMP synthase (glutamine-hydrolyzing) (Dechlorosoma suillum PS)
MAHQKILILDFGSQVTQLIARRVREAKVFCEIHPYDVSEEFIRNYGAKGIILSGGPSSVT
EGDTPRAPKVVFELGIPVLGICYGMQTMAQQLGGTVMTAEAAGKAREFGYSEVRAHGHTA
LLKDIADFTTPEGHGMLKVWMSHGDSVMELPPGFKLMASTPSCPIAGMADEERKFYAVQF
HPEVTHTVKGRAILESFVHGICGCGTDWVMGDYIAEAVAAIRAQVGSEEVILGLSGGVDS
SVAAALIHKAIGDQLTCVFVDHGLLRLNEGDMVMDMFARNLGVKVIRVDAVDDFMGKLAG
VSDPEQKRKIIGKEFVEVFQAESKKLSAAKWLAQGTIYPDVIESAGKGKKGAHTIKSHHN
VGGLPEDMHLKLLEPLRELFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKQEY
AKLLQRADAIFIDELRATLATERDVAAGACTEADIGKSWYDLTSQAFAVFLPVKSVGVMG
DGRTYENVVALRAVVTSDFMTAHWAHLPYELLGKVSNRIINEVRGLNRVVYDVSGKPPAT
IEWE