Protein Info for Dsui_2670 in Dechlorosoma suillum PS

Annotation: GMP synthase (glutamine-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 6 to 204 (199 residues), 235.1 bits, E=4.1e-74
• PF00117: GATase
  • amino acids 7 to 199 (193 residues), 142.3 bits, E=3.8e-45
• PF07722: Peptidase_C26
  • amino acids 72 to 183 (112 residues), 42.9 bits, E=1.2e-14
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 544 (332 residues), 463.4 bits, E=3.7e-143
• PF02540: NAD_synthase
  • amino acids 223 to 289 (67 residues), 30.9 bits, E=3.9e-11
• PF03054: tRNA_Me_trans
  • amino acids 229 to 261 (33 residues), 20.9 bits, see alignment (E = 6.2e-08)
• PF00958: GMP_synt_C
  • amino acids 458 to 543 (86 residues), 137 bits, E=4.5e-44

Best Hits

Swiss-Prot: 94% identical to GUAA_DECAR: GMP synthase [glutamine-hydrolyzing] (guaA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 94% identity to dar:Daro_2337)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• L-glutamate and L-glutamine biosynthesis (6/7 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See G8QPB9 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Dsui_2670 GMP synthase (glutamine-hydrolyzing) (Dechlorosoma suillum PS)
MAHQKILILDFGSQVTQLIARRVREAKVFCEIHPYDVSEEFIRNYGAKGIILSGGPSSVT
EGDTPRAPKVVFELGIPVLGICYGMQTMAQQLGGTVMTAEAAGKAREFGYSEVRAHGHTA
LLKDIADFTTPEGHGMLKVWMSHGDSVMELPPGFKLMASTPSCPIAGMADEERKFYAVQF
HPEVTHTVKGRAILESFVHGICGCGTDWVMGDYIAEAVAAIRAQVGSEEVILGLSGGVDS
SVAAALIHKAIGDQLTCVFVDHGLLRLNEGDMVMDMFARNLGVKVIRVDAVDDFMGKLAG
VSDPEQKRKIIGKEFVEVFQAESKKLSAAKWLAQGTIYPDVIESAGKGKKGAHTIKSHHN
VGGLPEDMHLKLLEPLRELFKDEVRELGVALGLPREMVYRHPFPGPGLGVRILGEVKQEY
AKLLQRADAIFIDELRATLATERDVAAGACTEADIGKSWYDLTSQAFAVFLPVKSVGVMG
DGRTYENVVALRAVVTSDFMTAHWAHLPYELLGKVSNRIINEVRGLNRVVYDVSGKPPAT
IEWE