Protein Info for Dsui_2654 in Dechlorosoma suillum PS

Annotation: DNA polymerase III, delta'' subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF13177: DNA_pol3_delta2" amino acids 12 to 179 (168 residues), 139.8 bits, see alignment E=4.3e-45 TIGR00678: DNA polymerase III, delta' subunit" amino acids 17 to 211 (195 residues), 201.5 bits, see alignment E=4.8e-64

Best Hits

KEGG orthology group: K02341, DNA polymerase III subunit delta' [EC: 2.7.7.7] (inferred from 59% identity to app:CAP2UW1_2470)

Predicted SEED Role

"DNA polymerase III delta prime subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPA3 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Dsui_2654 DNA polymerase III, delta'' subunit (Dechlorosoma suillum PS)
MNIFQLQESAWQRLQGRRAQLPHALLLIGQRGVGKFELARAFAAGLLCEAPGMDGHACGQ
CSACNWLGQGNHPDFRLVQPAAMSDEEAEADEETGKKKPSQQITIDQVRGLDDFLHVGTH
RQGVRIVLLHPAEAMNRNTANALLKSLEEPRPDTLFLLVSSEADRLLPTIRSRCQTVEVP
LPSPQAATAWLAAQKVSDGGRWLALAGGAPRLAAELAGSGQRSLLDALLGQLQKGRQLDP
IAAAALIEKTLKADKSGALTMKRTVEWLQKWSADLALVAEGLPPRYFQDDGATIGQLAAS
SSTIKIINFNRLLIKFKAQSEHPLNLRLVLEELFFAYRALY