Protein Info for Dsui_2651 in Dechlorosoma suillum PS

Annotation: ankyrin repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13637: Ank_4" amino acids 30 to 74 (45 residues), 29.5 bits, see alignment 2.2e-10 amino acids 98 to 141 (44 residues), 31.8 bits, see alignment 4e-11 amino acids 126 to 174 (49 residues), 44.2 bits, see alignment E=5.2e-15 amino acids 158 to 206 (49 residues), 38.3 bits, see alignment E=3.6e-13 PF12796: Ank_2" amino acids 31 to 86 (56 residues), 27.9 bits, see alignment E=8.4e-10 amino acids 61 to 148 (88 residues), 71 bits, see alignment E=3.1e-23 amino acids 144 to 211 (68 residues), 51.7 bits, see alignment E=3.1e-17 PF13857: Ank_5" amino acids 43 to 92 (50 residues), 27.1 bits, see alignment E=1.3e-09 amino acids 109 to 158 (50 residues), 28.3 bits, see alignment E=5.6e-10 amino acids 143 to 192 (50 residues), 27.4 bits, see alignment E=1.1e-09 PF00023: Ank" amino acids 57 to 88 (32 residues), 23.2 bits, see alignment 1.9e-08 amino acids 90 to 117 (28 residues), 20.3 bits, see alignment (E = 1.6e-07) amino acids 121 to 148 (28 residues), 25.7 bits, see alignment (E = 3.1e-09) amino acids 153 to 184 (32 residues), 28 bits, see alignment 5.6e-10 PF13606: Ank_3" amino acids 57 to 83 (27 residues), 18.7 bits, see alignment (E = 5.7e-07) amino acids 120 to 148 (29 residues), 26.2 bits, see alignment 2e-09 amino acids 156 to 181 (26 residues), 22.2 bits, see alignment (E = 4.1e-08)

Best Hits

KEGG orthology group: K06867, (no description) (inferred from 49% identity to app:CAP2UW1_2467)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPA0 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Dsui_2651 ankyrin repeat-containing protein (Dechlorosoma suillum PS)
MRKLLAALLLSLAFPLAQPVLAGIYDDTLKAVLENHTEEAVALLERGIDPNTADAEGSTL
LMLAARNGNAELVDQLILRRAKVTARNRFGDDALLLASFRGHLPVVKLLLAGGAPVNRSE
GWPPLAYAAFNNQLEVMEYLLAHGADINGTSDNGTTALMVAARNAHIEAVRLLLKHKPDV
DKINEAGGTALKWAVAANNTEIADLLRQAGAVLE