Protein Info for Dsui_2621 in Dechlorosoma suillum PS

Annotation: ATPase involved in chromosome partitioning

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF13614: AAA_31" amino acids 6 to 179 (174 residues), 81.5 bits, see alignment E=2.7e-26 PF10609: ParA" amino acids 6 to 54 (49 residues), 37 bits, see alignment 9e-13 PF06564: CBP_BcsQ" amino acids 6 to 157 (152 residues), 23.8 bits, see alignment E=1e-08 PF01656: CbiA" amino acids 8 to 237 (230 residues), 62.6 bits, see alignment E=1.3e-20 PF02374: ArsA_ATPase" amino acids 11 to 53 (43 residues), 27.8 bits, see alignment 5.3e-10 PF09140: MipZ" amino acids 78 to 159 (82 residues), 22 bits, see alignment E=3.2e-08

Best Hits

KEGG orthology group: None (inferred from 57% identity to bug:BC1001_2000)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNS8 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Dsui_2621 ATPase involved in chromosome partitioning (Dechlorosoma suillum PS)
MGQPVILSVTSTKGGVGKTTIAANIGALFAQFGMRVLLLDADVQPSLSKYFRIIQRAPFG
LTAVITRGGSVQPDCISTTDRTNLDLVVSDPLDSDGTALQSWLRDREDRLVVMKRAVQSP
YVRDNYDVVVIDTQGAVGELQKTAAMAADIMISPVNPTILSAREFASGTVNMLESINRLA
DFSADFRSGDLYALIYGMDRSNDSKLIADQIRNDFRSIHKVRVMQTVVPQSAAYRTAATL
QLPAYEIDRPPSKKSVTAYETLHQLVWELFPNLQDIYCDDVAADDDDSGTGQAATESQGE
QS