Protein Info for Dsui_2605 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 PF13188: PAS_8" amino acids 14 to 57 (44 residues), 30.2 bits, see alignment 9.2e-11 TIGR00229: PAS domain S-box protein" amino acids 14 to 129 (116 residues), 67.4 bits, see alignment E=1.3e-22 PF08448: PAS_4" amino acids 15 to 124 (110 residues), 46 bits, see alignment E=1.7e-15 PF00989: PAS" amino acids 15 to 120 (106 residues), 48.5 bits, see alignment E=2.4e-16 PF13426: PAS_9" amino acids 20 to 122 (103 residues), 56.1 bits, see alignment E=1.2e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 132 to 294 (163 residues), 150.7 bits, see alignment E=3.2e-48 PF00990: GGDEF" amino acids 134 to 291 (158 residues), 171.4 bits, see alignment E=3.9e-54 PF00563: EAL" amino acids 313 to 544 (232 residues), 235.8 bits, see alignment E=1.4e-73

Best Hits

KEGG orthology group: None (inferred from 43% identity to ddc:Dd586_3389)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNR2 at UniProt or InterPro

Protein Sequence (578 amino acids)

>Dsui_2605 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MDNKEQLQALKGKAFDASGEGILITDPRGVILAVNKKFEEITGYSSVDVLGQTPRILASG
RHDEAFYRDMWDLVMEQGLWSGLIWNRRRTGDEYLEQFSISAVYARDGTVEGYIGVMRDI
TDQKLQEDRIKYLASHDVLTGLLNRHALDTRLERAILHAKRRQARLALMFLDLDRFKQIN
DILGHDVGDELLKTVAQRLRECVREEDTIARQGGDEFILLLEDLEDNKGSIAHTAQRIID
SLAKDFEIMGCALSASASIGIALYPENGHTQAELVKHADLAMYHAKASGRGNFQFFNAEL
DAQVRQNVALESDLRAAIAAGGQQFVLHYQPKINLATGRVVSLEALIRWHHPQLGMVPPA
EFITLAEDVHLITPLSRWLVGEVAAQITRWGDDALPVAINISPAQFRQANFVEELLEITG
SHGVPPGMIELEITEGVFINDMENAIKTLQAARDTGFRVALDDFGTGYSSLRYLVSLPID
VLKIDRSFVSDQNQVCMAIVRFLVNLGQELGVEIVAEGVETLEQAHYLYKAGCTVGQGYL
FSRPLPVADVLPFLRETGVTDRHDQDIEVMHLTARASS