Protein Info for Dsui_2574 in Dechlorosoma suillum PS

Annotation: integral membrane protein (PIN domain superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 55 to 76 (22 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 209 to 232 (24 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details PF04610: TrbL" amino acids 153 to 292 (140 residues), 26.7 bits, see alignment E=2.2e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN85 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Dsui_2574 integral membrane protein (PIN domain superfamily) (Dechlorosoma suillum PS)
MKSYVRWFLVLLLLGLSRFAVAAESSMISVDDFADMIQSLKAAARMMSPYLVDEGIGLTS
IFFGIGAFILLIKLFFGPGDPGVKANIFLHVAKAVLVIAMLASWVSYGSGPNQEVVTPMG
NGSARLSNYKLPFSVENLMVDPFDGIVNGMFDKFGGGGGKEKLFNVIAQSWAKMWEASDK
REELRNKYATDLNPLSYIKFWLQSMGDKIITFLFACVVALLALLLMVIYVFVIYLGDILA
FLGMFVGPLMLPSMLFPPFSYLSDSWFKFMISAGFFKIIAAWTALVTMKTVEQIQVVANK
MYEKMLASAGTVETIQNGYVMGGGLVVSMIMTVVYMAFAIFLMVQVWKLTDALMQGRGGL
GISALDGAASKLRG