Protein Info for Dsui_2548 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF02623: FliW" amino acids 3 to 131 (129 residues), 117.1 bits, see alignment E=2.2e-38

Best Hits

Swiss-Prot: 57% identical to FLIW_DECAR: Flagellar assembly factor FliW (fliW) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K13626, flagellar assembly factor FliW (inferred from 57% identity to dar:Daro_2743)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN59 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Dsui_2548 hypothetical protein (Dechlorosoma suillum PS)
MQVQTHLFGTIEVDPDTVISFPAGLTGFESSVRYKLVHEAAEGEPVSFTLQSVDNPSVAF
QIIDPTAIGFQYELELSDAERVALKVDQPEDVAVMLLLFKQETAKQLGANVRAPLLINVK
TRLGLQKVIGNCRPRITVSNLSSAVG