Protein Info for Dsui_2547 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF02743: dCache_1" amino acids 93 to 272 (180 residues), 52.1 bits, see alignment E=2.8e-17 PF22588: dCache_1_like" amino acids 187 to 272 (86 residues), 36.7 bits, see alignment E=1.6e-12 TIGR00229: PAS domain S-box protein" amino acids 328 to 451 (124 residues), 61.6 bits, see alignment E=8.3e-21 PF13188: PAS_8" amino acids 332 to 382 (51 residues), 24.5 bits, see alignment 7.8e-09 PF00989: PAS" amino acids 332 to 442 (111 residues), 42 bits, see alignment E=3.5e-14 PF08448: PAS_4" amino acids 337 to 447 (111 residues), 76.8 bits, see alignment E=6.3e-25 PF13426: PAS_9" amino acids 345 to 444 (100 residues), 37.5 bits, see alignment E=9.9e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 453 to 616 (164 residues), 139.1 bits, see alignment E=1.2e-44 PF00990: GGDEF" amino acids 456 to 612 (157 residues), 165.1 bits, see alignment E=4.8e-52 PF00563: EAL" amino acids 633 to 868 (236 residues), 251.2 bits, see alignment E=3.6e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN58 at UniProt or InterPro

Protein Sequence (889 amino acids)

>Dsui_2547 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MTKQNGISSRQFVYVVIALLALAGFCALLGLELNHSYDTEMAFARRNVENLADSLEGRTR
GAVEKIDLVLLEVQYSMQQRLAKGPVSPQAVNAELARLLSRIPESQSLRVADATGTFRYD
ASGKISSQSIGDRAYFQRNKNDPKAGLVFSEPIFARITQNWVITLSRSLRDKDGRFLGLV
QAAVNADSLQQHFQTLNVGEGGVVALYDAELRLIARTPPLPNRLGKSILNTEISDNIRSR
EKGAFEALSHQDGIRRVFGFRRLENLPFVVFVGLSRDEVLSEWYRKLTYYGATAVVLALA
LLGLILVWQRSYVRAVSMAHTMTNAYDESSSRIRALLDSIPDLAWIKDNAFRFHAVNEAY
ARMCGKPAEEIVGKTVFQVWPEALARTFQNHDEAVLASGKPGHFEVLVTNGEGQPRTLDY
IRVPVHNEEGEVVGMAGIARDITERKEAEARIRHLAEHDALTDLPNRSLLSSRMADAINR
SVGSQAPMALLLLDLDHFKNINDSLGHEVGDKLLQLAAERLRHTLDAADTLSRSGGDEFA
ILLTECSGAPMIGRIAQRLLETMAQPFNVDGHELVLSASVGISMYPHDGTDLGALLKNAD
AAMYSAKAAGRNTYQFFTPEMNARVFERLSLENSLRKALPRQELMLYYQPQYRVGGGDPI
GFEALLRWRHPELGLVPPARFIPIAEETNLILPIGEWVLAEACRQQMAWQRAGQPATTVA
VNLSPVQFRQRNLVSLVQRVLAETGLPAAQLELEITESLLMDDTERAVEVLHELKSLGIR
LSLDDFGTGYSSLSYLKRFPLDKIKIDQSFVRDMIKDSGDAAIIQAIIAIAAKLELGVIA
EGVENQSQLDYLALHQCGEVQGYLFSPPVPAAEVCRFFNSATRAPAPMA