Protein Info for Dsui_2546 in Dechlorosoma suillum PS

Annotation: transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 771 PF09371: Tex_N" amino acids 5 to 77 (73 residues), 108 bits, see alignment E=5.5e-35 PF22706: Tex_central_region" amino acids 132 to 313 (182 residues), 252.2 bits, see alignment E=1.1e-78 PF16921: Tex_YqgF" amino acids 329 to 456 (128 residues), 177.6 bits, see alignment E=4.6e-56 PF12836: HHH_3" amino acids 496 to 560 (65 residues), 97.1 bits, see alignment E=1.8e-31 PF17674: HHH_9" amino acids 566 to 635 (70 residues), 88.2 bits, see alignment E=1.9e-28 PF23459: S1_RRP5" amino acids 653 to 719 (67 residues), 27.1 bits, see alignment E=1.8e-09 PF00575: S1" amino acids 654 to 725 (72 residues), 79 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 75% identity to dar:Daro_2744)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN57 at UniProt or InterPro

Protein Sequence (771 amino acids)

>Dsui_2546 transcriptional accessory protein (Dechlorosoma suillum PS)
MLPPIEHRIAEELGARPQQVMAAVALLDEGATVPFIARYRKEVTGGLDDTQLRNLEERLT
YLRELEDRRAAVLASIDEQGKLTPELKAAVDMADTKQRLEDLYLPYKQKRRTKAQIAREA
GLQPLADALLADPTLVPESEAEKYFNAEAGFADTKAVLDGARQILMEQFAEDAELLGSLR
TYLDEHGILKSTLIAGQEEAGAKFRDYFEYSEAISDIPSHRALALFRGRNEGAISLALVL
DSELDEENKPLGPNPCELRIAKRFGIKDQGRPADKWLADTVRWAWRVKMALHLETELMTV
LREKAEEEAIRVFGRNLKDLLLAAPAGQKATMGLDPGLRTGVKVAVVDQTGKLLDTATIY
PHEPRRDWEGSLHTLAVLAQKHNVNLIAIGNGTASRETDKLAADLIRIASPHMALAKVVV
SEAGASVYSASEFAAREFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVS
QTKLARALDGVVEDCVNAVGVDVNTASIPLLARISGLNQTLAANIVAYRDQHGPFPNRLA
LKNVPRLGDKTFEQAAGFLRVPSSDNPLDASAVHPEAYPVVERILADIKKGIKEVIGDAR
LVKSLQPVKYTDEKFGLPTVQDILKELEKPGRDPRPEFKTAVFKDGVEEMRDLQPGMILE
GVVTNVAAFGAFVDIGVHQDGLVHVSALSTKFVKDPHEVVKAGDIVKVKVLEVDMARKRI
ALTMRLDDAFGKSTGGGKPAGAPMTAKARQREDAQPAGQNAMAAAFAKLKR