Protein Info for Dsui_2542 in Dechlorosoma suillum PS

Annotation: FAD/FMN-dependent dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 195 to 214 (20 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details PF01565: FAD_binding_4" amino acids 40 to 177 (138 residues), 127.5 bits, see alignment E=3e-41 PF02913: FAD-oxidase_C" amino acids 217 to 467 (251 residues), 177 bits, see alignment E=5.7e-56

Best Hits

KEGG orthology group: None (inferred from 67% identity to tmz:Tmz1t_3118)

Predicted SEED Role

"D-2-hydroxyglutarate dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN53 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Dsui_2542 FAD/FMN-dependent dehydrogenase (Dechlorosoma suillum PS)
MNDLQQQLAAIVGPVHVLTGEAELAPYLTDWRGRYRGRALALVKPGSTDEVAAVVRACAA
AGVPMVPQGGNTSLCGAATPDQGGCSVLVNLSRLNRIRQIDAANNAITVEAGCLLAQVQE
AAAAAGRLFPLALASEGSCQIGGNLSTNAGGVQVLRYGNTRELTLGLEVVLPDGRLWNGL
TALRKDNTGYDLKDLFIGAEGTLGIITAAVLKLFPRPRAVVTAWLAVADGAAAIALLGRA
QARFDARLTAFELISRQSLDLVLQHIPGSRQPLAAPAPWQVLLELADGGAWADLQADLED
FIGGEMADGRVQDGVLAQNETQARQLWALRENISEAQKIEGLSIKHDISVPVSRIPEFLD
LAGTALAAAFPGVRVVAFGHAGDGNLHYNLSKAQRQDNDTFIAATPQANRIVHDLVARLG
GSISAEHGIGQLKREELVRYKDPVGLDLMRCIKSSLDPRGLMNPGKIL