Protein Info for Dsui_2540 in Dechlorosoma suillum PS

Annotation: ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 16 to 444 (429 residues), 324.9 bits, see alignment E=7.5e-101 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 16 to 443 (428 residues), 554.8 bits, see alignment E=1.5e-170 PF00919: UPF0004" amino acids 17 to 93 (77 residues), 64.5 bits, see alignment E=1.1e-21 PF04055: Radical_SAM" amino acids 151 to 329 (179 residues), 84.6 bits, see alignment E=1.4e-27 PF18693: TRAM_2" amino acids 387 to 447 (61 residues), 63.7 bits, see alignment E=2e-21

Best Hits

Swiss-Prot: 82% identical to RIMO_DECAR: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 82% identity to dar:Daro_2751)

MetaCyc: 68% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN51 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Dsui_2540 ribosomal protein S12 methylthiotransferase RimO (Dechlorosoma suillum PS)
MSSGNTPTRSPLQTPTVGFVSLGCPKASSDAERILTQLRAEGYEISSSYDGADLVIVNTC
GFIDAAVEESLDAIGEALTENGKVIVTGCLGAKGDIVQSTHPSVLAVTGPHAAEEVMGHV
HSHLPKPHDPFMDLVPEAGIRLTPQHFAYLKISEGCNHSCTFCIIPSLRGPLVSRPIGDV
LQEAKALAEAGVKELLVISQDTSAYGVDLKYRTGFVGGRPVKTRLKELCEALAEFGIWVR
LHYVYPYPSVDDLIPLMAEGKILPYLDVPFQHASPRILKAMKRPASAENNLERIRAWRAI
CPDITIRSTFIAGFPGETEAEFEELLQFLEEARLDRVGCFAYSPVDGATANDLPGALPDE
VREERRRYVMELQEDISADLLAAKIDKEITVLVDAVDEEGAIARSSADAPEIDGVVYLDG
VFDVEPGDFVKVRVVDSDAHDLYAERV