Protein Info for Dsui_2538 in Dechlorosoma suillum PS

Annotation: acetoacetyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01829: acetoacetyl-CoA reductase" amino acids 3 to 245 (243 residues), 386.4 bits, see alignment E=2.9e-120 PF00106: adh_short" amino acids 3 to 197 (195 residues), 215 bits, see alignment E=1.5e-67 PF01370: Epimerase" amino acids 5 to 180 (176 residues), 26.3 bits, see alignment E=9.5e-10 PF08659: KR" amino acids 5 to 186 (182 residues), 83.4 bits, see alignment E=4e-27 PF13561: adh_short_C2" amino acids 9 to 243 (235 residues), 212.7 bits, see alignment E=1.2e-66

Best Hits

Swiss-Prot: 74% identical to NODG_AZOBR: Nodulation protein G (nodG) from Azospirillum brasilense

KEGG orthology group: K00023, acetoacetyl-CoA reductase [EC: 1.1.1.36] (inferred from 75% identity to app:CAP2UW1_3919)

MetaCyc: 57% identical to hydroxyvaleryl-CoA reductase / acetoacetyl-CoA reductase (Cupriavidus necator)
Acetoacetyl-CoA reductase. [EC: 1.1.1.36]; 1.1.1.36 [EC: 1.1.1.36]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN49 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Dsui_2538 acetoacetyl-CoA reductase (Dechlorosoma suillum PS)
MSKVALVTGALGGLGTAISQALAKEGYKVVAAYHPEFDKKEEWLAEQEAAGFKDFVLVPG
DVSDYESAKAMIAEAEAKAGPIDILVNNAGITRDKFFVKMDKGQWDAVINTNLNSLFNVT
HHVAAKMGERGWGRIVNISSVNGVKGQAGQTNYSAAKAGVIGFTKALAQEFAAKGVTVNA
IAPGYVATKMVTAIREDILKGIIDSVPMKRLAKPEEIGAAVVYLTSELAGFVTGATLNIN
GGLYYQ