Protein Info for Dsui_2534 in Dechlorosoma suillum PS

Annotation: TRAP transporter, DctM subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 49 to 68 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 278 to 304 (27 residues), see Phobius details amino acids 316 to 345 (30 residues), see Phobius details amino acids 357 to 382 (26 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details PF06808: DctM" amino acids 6 to 418 (413 residues), 360.1 bits, see alignment E=7.7e-112 TIGR00786: TRAP transporter, DctM subunit" amino acids 16 to 423 (408 residues), 372.6 bits, see alignment E=1.1e-115

Best Hits

Swiss-Prot: 38% identical to DCTM_RHOCA: C4-dicarboxylate TRAP transporter large permease protein DctM (dctM) from Rhodobacter capsulatus

KEGG orthology group: None (inferred from 69% identity to dar:Daro_3389)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN45 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Dsui_2534 TRAP transporter, DctM subunit (Dechlorosoma suillum PS)
MSWLLFLSFFALMLLGVPLGTAMGLAGLAVVFFGDLGLMSLPTSVYTGIAKYPLLAIPVF
VLAGMIFERSGVALRLVRFAVALVGQRRGGLALAAILVCMVLGGISGSGPADAAAVATVM
IPSMARAGYPAAFSASVIAAAGSTAILIPPSIVFILYSVLVPQASVPALFAAGLIPGLLA
GLALMLPAWWLSVRHGFGVAGLQDGEARQSFWSALKEASWGLLAPVIILGGMRSGAFTPT
EAAVVAVFYGLFVGLVIYRTLNWKNIYEVLVESAEVSAVVMLIIALASVFAWAGSTLGTF
EALGGWLVGLSGNETAILLAVTLLLLIAGMFLDAVSILFIFMPFLLPVILHFGWDPVWFG
VILTMNVAIGQFTPPMAINLMVTSRIAGIRIEDTVPWVLWMVGAMLSALLLVTFVPELAT
GIPRYLGYQ