Protein Info for Dsui_2533 in Dechlorosoma suillum PS

Annotation: TRAP-type C4-dicarboxylate transport system, small permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details PF04290: DctQ" amino acids 27 to 156 (130 residues), 107.2 bits, see alignment E=3e-35

Best Hits

KEGG orthology group: None (inferred from 64% identity to dvu:DVU0706)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN44 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Dsui_2533 TRAP-type C4-dicarboxylate transport system, small permease component (Dechlorosoma suillum PS)
MDDQQNPPSRPTARIERALAAGCMALLCLITFANVLVRYLTNASFAFTEEFSVFLLLVLT
LLGSAGAFADGRHIRITLLVDRLSANGRRLCSALEWLANVAMFGLLAWLGYGMAYDDFEF
EVTSPGLGLPQWWYSAWLPLLSALIVLRLFLLLWRRRGGRA