Protein Info for Dsui_2529 in Dechlorosoma suillum PS

Annotation: outer membrane assembly lipoprotein YfiO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 6 to 251 (246 residues), 301.2 bits, see alignment E=2.7e-94 PF09976: TPR_21" amino acids 32 to 100 (69 residues), 26.3 bits, see alignment E=2e-09 PF13512: TPR_18" amino acids 33 to 170 (138 residues), 139.6 bits, see alignment E=3.1e-44 PF13525: YfiO" amino acids 35 to 238 (204 residues), 233.4 bits, see alignment E=8.2e-73 PF13174: TPR_6" amino acids 48 to 66 (19 residues), 12.5 bits, see alignment (E = 7.4e-05) amino acids 78 to 105 (28 residues), 17.2 bits, see alignment (E = 2.3e-06)

Best Hits

Swiss-Prot: 45% identical to BAMD_NEIMA: Outer membrane protein assembly factor BamD (bamD) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K05807, putative lipoprotein (inferred from 75% identity to app:CAP2UW1_3923)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN40 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Dsui_2529 outer membrane assembly lipoprotein YfiO (Dechlorosoma suillum PS)
MRSLPALALIFAALLSLSGCGLLPEQKDETAGWSANKLYTQAKEAMSEGSWDKAVKYFEK
LESRYPYGRYAQQAQIEVAYAYFKSGETASAIAACDRFVKLHPDHPNVDYIYYLKGLVTF
NEDLGMMGHVSMQDQTERDPKGMRESFDAFKTLSSRFPDSKYTPDAVQRMKYLVSAMAAN
EVHVARYYMKRKAYVAAANRAQSAIKNYPDAPAIEEALFIMVKAYDEMGMIDLRDDAERV
MRKNYPNSVYYTRGLNRVEPWWKLW