Protein Info for Dsui_2511 in Dechlorosoma suillum PS

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00072: Response_reg" amino acids 10 to 120 (111 residues), 92.5 bits, see alignment E=4e-30 PF08281: Sigma70_r4_2" amino acids 140 to 187 (48 residues), 27.8 bits, see alignment 3.1e-10 PF00196: GerE" amino acids 146 to 200 (55 residues), 73.6 bits, see alignment E=1.5e-24 PF13384: HTH_23" amino acids 152 to 190 (39 residues), 27.1 bits, see alignment 5.8e-10

Best Hits

Swiss-Prot: 45% identical to FIXJ_AZOC5: Transcriptional regulatory protein FixJ (fixJ) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: None (inferred from 63% identity to tbd:Tbd_1743)

Predicted SEED Role

"Transcriptional regulatory protein fixJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QN24 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Dsui_2511 response regulator (Dechlorosoma suillum PS)
MNYQPEACIVHVVDDDPGLRRSLRFLLDSVGWTVQLHASAEEFLDVVVAPNQPCCLLLDI
RMPSMSGLELQQVLRGRGITLPILFMTGHADVSMAVQAMKSGALDFIEKPFNDQKVLDAV
ASAIRQSAEAIDEAGRRQAANAILAQLSPREQQVAQLVAQGQPNKQIAATLNISEKTVHI
HRQHVMEKAGVSSAAELARLMLRANPAALD