Protein Info for Dsui_2495 in Dechlorosoma suillum PS

Annotation: mercuric transport protein periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02052: mercuric transport protein periplasmic component" amino acids 1 to 91 (91 residues), 149.8 bits, see alignment E=1.2e-48 PF00403: HMA" amino acids 25 to 85 (61 residues), 66.1 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 100% identical to MERP_PSEFL: Mercuric transport protein periplasmic component (merP) from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 100% identity to enc:ECL_A234)

Predicted SEED Role

"Periplasmic mercury(+2) binding protein" in subsystem Mercury resistance operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QML6 at UniProt or InterPro

Protein Sequence (91 amino acids)

>Dsui_2495 mercuric transport protein periplasmic component (Dechlorosoma suillum PS)
MKKLLSALALAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVDGVSKVDVTFETR
EAVVTFDDAKTSVQKLTKATEDAGYPSSVKN