Protein Info for Dsui_2485 in Dechlorosoma suillum PS

Annotation: response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF00072: Response_reg" amino acids 8 to 118 (111 residues), 121 bits, see alignment E=1.4e-39

Best Hits

Swiss-Prot: 44% identical to CHEY_LISIN: Chemotaxis protein CheY (cheY) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 59% identity to app:CAP2UW1_3927)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMK6 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Dsui_2485 response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain (Dechlorosoma suillum PS)
MSQRHPKILIVDDNDVMRALLRGILRNEDYQVVGEARNGIQALEMVERMTPDVVCLDVIM
PEMNGLETLKTIKRDFPQVSVIMITGNASKENVQEALELGANGFVVKPFNAAKVLEALSR
A