Protein Info for Dsui_2470 in Dechlorosoma suillum PS

Annotation: excinuclease ABC, C subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 TIGR00194: excinuclease ABC subunit C" amino acids 23 to 595 (573 residues), 597.9 bits, see alignment E=1.1e-183 PF01541: GIY-YIG" amino acids 33 to 104 (72 residues), 30.8 bits, see alignment E=1e-10 PF27096: UvrC_M" amino acids 116 to 210 (95 residues), 95.9 bits, see alignment E=6.2e-31 PF02151: UVR" amino acids 218 to 251 (34 residues), 31.9 bits, see alignment (E = 3e-11) PF22920: UvrC_RNaseH" amino acids 265 to 377 (113 residues), 96 bits, see alignment E=5.1e-31 PF08459: UvrC_RNaseH_dom" amino acids 393 to 549 (157 residues), 196.5 bits, see alignment E=9.5e-62 PF14520: HHH_5" amino acids 564 to 615 (52 residues), 47 bits, see alignment 1.1e-15

Best Hits

Swiss-Prot: 71% identical to UVRC_DECAR: UvrABC system protein C (uvrC) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 71% identity to dar:Daro_2038)

MetaCyc: 49% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMJ6 at UniProt or InterPro

Protein Sequence (616 amino acids)

>Dsui_2470 excinuclease ABC, C subunit (Dechlorosoma suillum PS)
MSESPEATAPAAGPAAPAFDAKTFLATLTDLPGVYRMLDAEGKVLYVGKAKNLKKRVSSY
FQRTVSSPRIALMVSRICGIDTTVTRSEAEALLLENNLIKSLDPPFNILFRDDKSYPYVQ
LTRDQFPRLAFFRGAPDRKADYYGPFPAASVVRDSIHLLQKTFHLRTCEDSVFANRSRPC
LLYQIHRCSGPCVGLISAEDYAKDVQLAAMFLKGKQHEVIQRLTEAMEQASMALAFEQAA
VLRDRIQGLRRIQEKQYVDSGRDEDADVVVAVQESGMLCLNLAMIRGGQHLGDKPLFPKN
AADCEPAEAIAAFLDQHYREHPIPARILVNVPPADEEAAESLAALAERPVPIQEPRQTAH
RMWVEMAVQNARIAIASRRATLSMQGQRLEALQEALGLAELPQRIECFDISHTQGEATVA
SCVVYQGNGMRKSEYRRYNIRDIQKGDDYAAMRQAVSRRYDKVAVGEGVCPDLILIDGGK
GQVGVAYSALEELGLAHVPMIGVAKGVERKVGLEQLIFPDGRKPLQLPSTHPALHLIQEI
RDESHRFAVSGHRAQRGKARRTSTLEEIPGVGPTRRKALIAHFGGLQGIAGASVDRLAEV
PGISRDLAERIYSALH