Protein Info for Dsui_2454 in Dechlorosoma suillum PS

Annotation: Positive regulator of sigma E activity

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 78 to 99 (22 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details PF04246: RseC_MucC" amino acids 8 to 139 (132 residues), 103.2 bits, see alignment E=5.1e-34

Best Hits

KEGG orthology group: K03803, sigma-E factor negative regulatory protein RseC (inferred from 44% identity to app:CAP2UW1_1544)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMI0 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Dsui_2454 Positive regulator of sigma E activity (Dechlorosoma suillum PS)
MIETQATVTALEGDYALVEASQGGCGRCHEQGGCGGNNASQLFCHGPRHFRVLNPLGVKV
GEKVVVGVPDGAVSHSVLVLYLLPLALLVLGAVAGAALMPGARDAAAAAGALFGGFLAWF
LARRLQARDAQSPRFQPVIRQRL