Protein Info for Dsui_2446 in Dechlorosoma suillum PS

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 1 to 319 (319 residues), 428.2 bits, see alignment E=9e-133 PF08545: ACP_syn_III" amino acids 107 to 184 (78 residues), 115.1 bits, see alignment E=1.7e-37 PF08541: ACP_syn_III_C" amino acids 230 to 318 (89 residues), 130.1 bits, see alignment E=4.3e-42

Best Hits

Swiss-Prot: 75% identical to FABH_AZOSB: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Azoarcus sp. (strain BH72)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 80% identity to dar:Daro_2015)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMH2 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Dsui_2446 3-oxoacyl-(acyl-carrier-protein) synthase III (Dechlorosoma suillum PS)
MYAKITGVGSYLPAQAVSNDDLVARGVDTSDEWIATRTGIRNRHLAEPGQTSSDLGFEAA
RRALEMAGVDAAELDLIIVATSTPDFIFPSTACLLQSKLGNKGATCFDVQAVCAGFVYAL
SIAEKFVRSGSHKKALVVGAEVFSRILDWNDRGTCVLFGDGAGAVVLEASDAPGILATAL
HADGSHHGILSVPGNVAGGAVIGDPFLRMDGQAVFKFAVRVLADVAAETCAAAGVATSDV
DWLVPHQANLRIIDSTGKKLGIPSDKVVVTVDRHGNTSAASVPLALDTAVRDGRIQRGQK
VLLEGVGGGFTWGAVLFQF