Protein Info for Dsui_2438 in Dechlorosoma suillum PS

Annotation: haloacid dehalogenase superfamily enzyme, subfamily IA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF00702: Hydrolase" amino acids 6 to 179 (174 residues), 98.5 bits, see alignment E=1.7e-31 PF12710: HAD" amino acids 8 to 176 (169 residues), 54.3 bits, see alignment E=6e-18 PF13419: HAD_2" amino acids 8 to 185 (178 residues), 126.8 bits, see alignment E=2.5e-40 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 86 to 179 (94 residues), 39.7 bits, see alignment E=9.3e-14 PF13242: Hydrolase_like" amino acids 141 to 200 (60 residues), 55.6 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 72% identity to app:CAP2UW1_1528)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMG4 at UniProt or InterPro

Protein Sequence (218 amino acids)

>Dsui_2438 haloacid dehalogenase superfamily enzyme, subfamily IA (Dechlorosoma suillum PS)
MAKRFDLVVFDWDGTLLDSAAAIVSAVQAACVDLGLPVPSDAQARHVIGLGLSDALRSAV
PDLEPAQYPLMVERYRHHYLSRDHELALFAGAVELVRELEAAGHLLAVATGKSRLGLDRA
LKVSGLGPHFHSSRCADECFSKPHPQMLEELMAELAVAPERTVMIGDTTHDLQMARNAGV
DALAVSYGAHEPEVLLAHGPLETFSRLEDLAAWLRHHA