Protein Info for Dsui_2434 in Dechlorosoma suillum PS

Annotation: excinuclease ABC, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 TIGR00631: excinuclease ABC subunit B" amino acids 21 to 676 (656 residues), 1083.2 bits, see alignment E=0 PF04851: ResIII" amino acids 32 to 135 (104 residues), 38.4 bits, see alignment E=3.8e-13 PF00270: DEAD" amino acids 33 to 178 (146 residues), 26.8 bits, see alignment E=1.2e-09 PF17757: UvrB_inter" amino acids 175 to 265 (91 residues), 113.7 bits, see alignment E=1.1e-36 PF00271: Helicase_C" amino acids 451 to 560 (110 residues), 75.2 bits, see alignment E=1.5e-24 PF12344: UvrB" amino acids 567 to 609 (43 residues), 78.9 bits, see alignment 5.8e-26 PF02151: UVR" amino acids 644 to 678 (35 residues), 29.5 bits, see alignment (E = 1.4e-10)

Best Hits

Swiss-Prot: 84% identical to UVRB_DECAR: UvrABC system protein B (uvrB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 84% identity to dar:Daro_2003)

MetaCyc: 71% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QMG0 at UniProt or InterPro

Protein Sequence (690 amino acids)

>Dsui_2434 excinuclease ABC, B subunit (Dechlorosoma suillum PS)
MSTSPSSPQTAEVVTFPGSPYRLHQPFPPAGDQPEAIRLLVEGLEDGLSYQTLLGVTGSG
KTYTMANVIARTGRPALILAPNKTLAAQLYAEFREFLPENAVEYFVSYYDYYQPEAYVPS
RDLFIEKDSSINDHIEQMRLSATKSLLERRDVVIVATVSCIYGIGDKDDYHNMILHLRQG
DKAGQRDIIKRLSEMQYERNEVDFQRGTFRVRGDVIDIFPAEHAEHAIRVCLFDDEIETL
QLFDPLTGHLLHKLPRFTIYPSSHYVTPRATVLRAVEGIKEELRKRLEFFHKEQRLVEAQ
RIEQRTRFDLEMLNELGFCKGIENYSRHLSGRKPGEAPPTLLDYLPPDALMFIDESHVAI
GQVGAMYKGDRSRKENLVDYGFRLPSALDNRPLKFEEFERLMRQTIFVSATPSDYEKQHQ
GQVVEQVVRPTGLIDPVVLVRPAMTQVDDLLSEIRKRIAVSERVLVTTLTKRMAEDLTDY
LRENGIKVRYVHSDIDTVERVEIIRDLRLGEFDVLVGINLLREGLDIPEVSLVAILDADK
EGFLRSERSLIQTIGRAARHLNGTAILYADRVTDSMRRAMDETERRRAKQMAHNEAHGIT
PKGVSKRIKDIIDGVYDPDAAQKELKAAQQQAVYETMSEKNLAKEIKRLEKQMLESAKNL
EFEKAAAARDELFRLKQQAFGAAVHDRDET