Protein Info for Dsui_2425 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 80 to 202 (123 residues), 46.3 bits, see alignment E=4.5e-16 PF08447: PAS_3" amino acids 104 to 189 (86 residues), 65.5 bits, see alignment E=8.7e-22 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 206 to 366 (161 residues), 145.1 bits, see alignment E=1.6e-46 PF00990: GGDEF" amino acids 207 to 363 (157 residues), 178.1 bits, see alignment E=2.4e-56 PF00563: EAL" amino acids 385 to 627 (243 residues), 249.5 bits, see alignment E=6.1e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLZ5 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Dsui_2425 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPQILPLILGTADSTPPQGVGLHRSWHSWPPLLLLAACISAGLAAVYVEQPWLSWLTFLA
CGVAAVCSVREIVILRRAARAYELAMEGAHDGMWTWNPLSKELTAGQRLHAILGYGENFL
MDTHAWLTLVHPEDTARYNRAVSEHLKGLTPHFYCEYRVRAKSGEYRWIASRGIAVRDAR
GVATLMAGSVTDITERKLHEERMRYLAHHDQLTGLPNRLLLADRLPQALTRAKRQQSRAA
VLFVDLDRFKNINDSLGHNQGDRLLQSVARRLQECLRQSDTIVRQGGDEFIVILEDLQLP
EQAGQIGAKLLETLASPYREDGYDFFLTASIGIALYPDDGDDADTLLRNADTAMYEGKSS
GGNTVRFYTGRMNERLQSRVSLENGLRRALERDELQLYYQPQIDLASGRLLGAEALLRWN
DGGRLIPPDQFIPVAEETGLIVPIGLWVLDTAIARAAAWRRHWQLRQGMGATPPRIAINL
SARQFWGGGIAEHVLLRLEREGLPPSTIELEVTESVLLRQEADCLEELRRLREAGVGLAL
DDFGTGYSSLSYLRLLPIDTLKIDKSFIFPLDEDQDGEAAAIVRAILAMAHTLGHKVVAE
GVERQTQLELLRTMGCDSFQGYLESRPLPPEAFLQRYCP