Protein Info for Dsui_2418 in Dechlorosoma suillum PS

Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 TIGR00503: peptide chain release factor 3" amino acids 9 to 525 (517 residues), 774.8 bits, see alignment E=3.8e-237 PF00009: GTP_EFTU" amino acids 14 to 273 (260 residues), 173.4 bits, see alignment E=1e-54 TIGR00231: small GTP-binding protein domain" amino acids 18 to 155 (138 residues), 74.4 bits, see alignment E=8.8e-25 PF01926: MMR_HSR1" amino acids 18 to 145 (128 residues), 25.8 bits, see alignment E=2.4e-09 PF22042: EF-G_D2" amino acids 291 to 377 (87 residues), 86.8 bits, see alignment E=2.2e-28 PF03144: GTP_EFTU_D2" amino acids 310 to 375 (66 residues), 36.1 bits, see alignment E=1.8e-12 PF16658: RF3_C" amino acids 383 to 510 (128 residues), 147.3 bits, see alignment E=5.8e-47

Best Hits

Swiss-Prot: 68% identical to RF3_NEIMB: Peptide chain release factor 3 (prfC) from Neisseria meningitidis serogroup B (strain MC58)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 70% identity to slt:Slit_2319)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLY8 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Dsui_2418 peptide chain release factor 3 (Dechlorosoma suillum PS)
MSAELQAIAAEAQRRRTFAIISHPDAGKTTLTEKLLLFGGAIQAAGTVKARKSGRHATSD
WMEIEKQRGISVASSVMQFDYRDCVINLLDTPGHQDFSEDTYRVLSAVDSALMVIDGAKG
VEPQTIKLLDVCRMRDTPILTFINKLDREVRDPFELLDEVESVLKIQCAPVTWPIGMGKT
FRGVYHLASDSVALFTPGEGKDAEVVKGLDHPSLAGFSMEIAKLKEDLELLAAAHQFEAE
PFLSGKLTPVFFGSAINNFGVREILDALVANAPPPKTRESAERAVAPEEGKFSGFIFKIQ
ANMDPAHRDRVAFLRVCSGRFERGMKLWQVRTGKEIRATQVVAFLSQRRATIDDAYPGDI
IGMFNHGSIEIGDSFTEGENLHFTGIPYFAPEMFRAARPKNPSKIKQFQKGLEQLGEEGA
IQVFKPLSGYEVVLGAVGVLQFEVVAHRLAAEYGVEILLENKSLFGARWVTCDKAEDFNR
FERENMGNLATDASGSLAYLAPTRVNLDLTQERYPSVQFHATREHTVTLGNRG