Protein Info for Dsui_2412 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 912 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 337 to 356 (20 residues), see Phobius details PF09084: NMT1" amino acids 48 to 254 (207 residues), 161 bits, see alignment E=1.5e-50 PF13188: PAS_8" amino acids 373 to 423 (51 residues), 16.1 bits, see alignment 3.1e-06 amino acids 493 to 539 (47 residues), 18.6 bits, see alignment 4.7e-07 amino acids 622 to 662 (41 residues), 34.3 bits, see alignment (E = 5.5e-12) PF00989: PAS" amino acids 373 to 478 (106 residues), 36.8 bits, see alignment E=1.3e-12 amino acids 494 to 606 (113 residues), 54.1 bits, see alignment E=5.1e-18 amino acids 620 to 728 (109 residues), 60.5 bits, see alignment E=5.5e-20 PF08448: PAS_4" amino acids 376 to 483 (108 residues), 29.3 bits, see alignment E=3e-10 amino acids 502 to 610 (109 residues), 46 bits, see alignment E=1.9e-15 amino acids 624 to 733 (110 residues), 49.8 bits, see alignment E=1.3e-16 TIGR00229: PAS domain S-box protein" amino acids 387 to 488 (102 residues), 41 bits, see alignment E=1.9e-14 amino acids 490 to 616 (127 residues), 86.7 bits, see alignment E=1.4e-28 amino acids 623 to 738 (116 residues), 72.1 bits, see alignment E=4.4e-24 PF13426: PAS_9" amino acids 388 to 480 (93 residues), 37.3 bits, see alignment E=1e-12 amino acids 506 to 608 (103 residues), 49.5 bits, see alignment E=1.6e-16 amino acids 628 to 730 (103 residues), 67.9 bits, see alignment E=2.9e-22 PF08447: PAS_3" amino acids 516 to 602 (87 residues), 46 bits, see alignment E=1.8e-15 amino acids 641 to 724 (84 residues), 41.3 bits, see alignment E=5.4e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 738 to 902 (165 residues), 139.9 bits, see alignment E=6.3e-45 PF00990: GGDEF" amino acids 742 to 899 (158 residues), 152 bits, see alignment E=4.3e-48

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLY2 at UniProt or InterPro

Protein Sequence (912 amino acids)

>Dsui_2412 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MRHSPSSRPLLPLCRHLSACLTFLLLILPAAPAQALENVTLQLRWRHQFQFAGYYAAQMQ
GYYREAGLAVDIREAEPGQDAVQAVLEGKAQYGVGTSDLLVHYHRGAPVLVLAVIFQHSP
LAIAARRAAGIRNIHDLNGKKVMIEPGANELLGYLGRERVDTDSLALEPHSQTVQDLLDG
RVDALSIYRTDELYELRKQGERVVVFTPESSGLDFYGDNLFSTQAELRQHPERLKAFRAA
SLKGWSYAMAHPQEVIDYILKHYGRRHSRDHLAFEAEQMVPLVQAQLVEPGYFHVGRWRH
MADTYADLGLLPRDLSLDDLLYAGEGGNAGSGSQSSLWFVAGMGALVAVALVVVLVRRYM
RRLRRSARNCLGLMEEAPFPVAVTRPEADGELLYINRCAEEYYGVSRHDVVGRPAQGFWR
NPEQRQQMVDELHRRGGRWLGFEVQLQGLEGKPVWVLMSAACIDFEGREAIVLSFHDITQ
RKRTEMALGQSEQRFRTLAESAYDVIWTMDLNGRFTYISPSVERLRGYTPEEVLQQSMAE
ALTPDSMSQAAEGFAYLLRTGQVLKHHWELEQPCKDGSTVWTDAIVNVLRDDEGHLTGLL
GITRDITAERKLRQELQSRSVAVDAAAEGVIITDANGVVEYANPAFCDMTGYSLEEVLGQ
RTSRFKSGVHDADFYRQLWGTITSGNPWRGEVVNRRKDGMLYHELLTIAPVKNEQGAVVR
YVAIKHDISERKRIEQRLEHLAHFDLLTDLPNRTLFFDRLQQAFFRAQRYQEGLAVLVLD
LDGFKAVNDSQGHQAGDLLLAAFAYRLKQTLRQSDTAARMGGDEFTVLLHGVRQDEDAVT
AANKVLEALVQPFDILGQRCQVSASIGVALFHQAYASPDMLVQAADGAMYEAKRAGKNRW
VLARPPQPAPES