Protein Info for Dsui_2403 in Dechlorosoma suillum PS

Annotation: universal bacterial protein YeaZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 TIGR03725: tRNA threonylcarbamoyl adenosine modification protein YeaZ" amino acids 3 to 210 (208 residues), 185.1 bits, see alignment E=8.7e-59 PF00814: TsaD" amino acids 32 to 143 (112 residues), 101 bits, see alignment E=4.8e-33

Best Hits

KEGG orthology group: K14742, hypothetical protease [EC: 3.4.-.-] (inferred from 59% identity to dar:Daro_1981)

Predicted SEED Role

"TsaB protein, required for threonylcarbamoyladenosine (t(6)A) formation in tRNA"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLX3 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Dsui_2403 universal bacterial protein YeaZ (Dechlorosoma suillum PS)
MNLLALETATDQGSVALWRDGVLLSRECPAGEQSSLTLLPLVRAMMAEAGLAMADLDGIA
FGAGPGAFTGLRVACGVAQGLAVALDRPVLPVVTLEAMAYADGSPQVAVYLDARMNEVYC
GAYRRVGEVLELQGAITVCPPAEAPLPAAGDWAVCGNGVPAYPALSQRLAAWPLGGQRVP
TAAAVARLAAPRLARGEGLDPALAAPLYIRDKVALTVAERLAQGGRA