Protein Info for Dsui_2394 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 986 TIGR00229: PAS domain S-box protein" amino acids 23 to 148 (126 residues), 39.2 bits, see alignment E=6.7e-14 PF13188: PAS_8" amino acids 26 to 84 (59 residues), 27.9 bits, see alignment 5.8e-10 PF00989: PAS" amino acids 27 to 138 (112 residues), 26.6 bits, see alignment E=1.7e-09 PF13426: PAS_9" amino acids 37 to 140 (104 residues), 25.7 bits, see alignment E=4.1e-09 PF08448: PAS_4" amino acids 46 to 141 (96 residues), 30.9 bits, see alignment E=9.6e-11 PF08447: PAS_3" amino acids 50 to 134 (85 residues), 51 bits, see alignment E=4.9e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 283 to 445 (163 residues), 150.6 bits, see alignment E=3.3e-48 PF00990: GGDEF" amino acids 286 to 443 (158 residues), 177.6 bits, see alignment E=5.9e-56 PF00563: EAL" amino acids 464 to 698 (235 residues), 261.2 bits, see alignment E=2.9e-81

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QLW4 at UniProt or InterPro

Protein Sequence (986 amino acids)

>Dsui_2394 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPKPPPAPRETRGIENVLTRLRQGENRFVQLADNIPESFWLIDIAARRVVYANPAYATHW
GGSVEDLYRNRFDWLRFIHPDDLDRMREAVRRNPRGGVNEVVRIVHPNGGERWLHIRSFD
MKDEQGNAHSVGGVGTDITDLVLQREALRASEAVQKGVLDALPAHIAILDAEGIIVAVNE
PWSRFAAENSHDPSSAGVGCNYIRVCERSWGESAEEAQDIAVGIRAVIDGLQHEFSLVYA
CHSPTEKRWFRVLVTPLEARGNRGAVVMHLNVTETVEAQQRLTHLAHFDSLTGLPNRLLF
RERLKAALAMVQRQGGRLAVMFIDLDRFKVVNDTLGHLAGDALLQQVAARIGGCLRASDT
VGRLGGDEFAVLVPDPEREYDVTVVARRLVDTLAQPITLEGQELFVSASIGITLYPDDCD
DLEKLIRNADTAMYRAKELGRNNFQFFTAAMNARVKEQLQLETDLRRAVQRQEFILHFQP
KVSCSHGGITGFEALLRWQHPVRGLVSPMEFIPLLEETGLIVPVGTWVLQQACQQAAAWH
LAGHGQLTVAVNLSARQLQSEALVQDVRQALEDSGLPPQALELELTESLLMSHVEDNIAL
LNRLKAMGVQLSVDDFGTGYSSLAYLKRLPLDTVKVDRAFVQDITADPGDASITRAVITM
AHNLRLKVVAEGVETEGQIALLVANHCDEMQGYYFSRPVPAPEALALLDKGRVLPGRLRA
RGVQVPTVLLVLTAPALRLTLGRALEEANLRVLLAGGGEEGLAALACQRVDAIVADAGLT
DSAGQAFLERAGQLQPEAGFLLLSSADNMAAAAAELPPHLAGHLLSRDVGTEVLVAGVLE
ALRQHSLLLENQRLTQEVHSAGLELSRLGQELESLLASHARQEIRPQQATGIAHEVLQEL
PAAVLGVDASGMVAYANAAAERLWPACGLIGNESADLLPPELLALLQAGGGSREITLNQG
GRCRALCQPFGNDAKTRGHLLLLLPL