Protein Info for Dsui_2358 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 181 to 200 (20 residues), see Phobius details PF00672: HAMP" amino acids 196 to 246 (51 residues), 36.3 bits, see alignment 8.6e-13 PF00512: HisKA" amino acids 251 to 314 (64 residues), 52.7 bits, see alignment E=5.4e-18 PF02518: HATPase_c" amino acids 362 to 474 (113 residues), 80.5 bits, see alignment E=1.9e-26

Best Hits

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL61 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Dsui_2358 signal transduction histidine kinase (Dechlorosoma suillum PS)
MSPRFYPKSFLKLLSLAFLAAALPLVVALVQTAMEVNLLVQQSRQAVGQTAQAARASRQL
LEQTVALERSARQYLVLGEPSLLADYDTLRAGFRTTFSELSLLPLDEAQLLELNRTIDTE
AALRERLEKIQGGKARLAEDYAALSDLARGVQRISDALTDREMSRLGELAGEAEQRLWKQ
LLAMLVLGLVVSALAAALIARPVRELEAAVSRLGGGDLQAPVAVHGPADLERLGQRLEWL
RQQLNELEAQKVRFLRHVSHELKTPLTALREGAELLADGAAGSLSEGQREIVAILQGKSR
QLQTMIERLLNAQRALDELGRLEFVPVDLARLVGRGLDDHRLAAQARGLLFQAECQPLMV
WGDRDKLATVLDNLLSNAVKYSPEGGMIAVALKSEDGLACLDVRDQGPGVAPNDRERIFD
WFYLGGSRPAAASVPGSGLGLAIARELAQAHRGRLEMLPEGPPGACFRLSLPLAAAGR