Protein Info for Dsui_2351 in Dechlorosoma suillum PS

Annotation: uncharacterized protein, gamma-carboxymuconolactone decarboxylase subunit like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF02627: CMD" amino acids 33 to 118 (86 residues), 77.4 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 88% identity to azo:azo3958)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL54 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Dsui_2351 uncharacterized protein, gamma-carboxymuconolactone decarboxylase subunit like protein (Dechlorosoma suillum PS)
MQNERYARGLAKLQEIDGQAGEKVVASLAGIAPDFARYLIEFPFGDIYSRPGLDLRAREI
AVVAALTALGNAAPQLKVHIQGALNVGVSRQEVVETIMQMAVYAGFPAALNGLFAAQEVF
AEAG