Protein Info for Dsui_2351 in Dechlorosoma suillum PS

Annotation: uncharacterized protein, gamma-carboxymuconolactone decarboxylase subunit like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02627: CMD
  • amino acids 33 to 118 (86 residues), 77.4 bits, E=3.4e-26

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 88% identity to azo:azo3958)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (2/4 steps found)
• aromatic compounds degradation via β-ketoadipate (3/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (3/11 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

See G8QL54 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Dsui_2351 uncharacterized protein, gamma-carboxymuconolactone decarboxylase subunit like protein (Dechlorosoma suillum PS)
MQNERYARGLAKLQEIDGQAGEKVVASLAGIAPDFARYLIEFPFGDIYSRPGLDLRAREI
AVVAALTALGNAAPQLKVHIQGALNVGVSRQEVVETIMQMAVYAGFPAALNGLFAAQEVF
AEAG