Protein Info for Dsui_2349 in Dechlorosoma suillum PS

Annotation: Zn-dependent hydrolase, glyoxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00753: Lactamase_B" amino acids 85 to 256 (172 residues), 71.4 bits, see alignment E=1e-23 PF12706: Lactamase_B_2" amino acids 98 to 247 (150 residues), 31.9 bits, see alignment E=1e-11

Best Hits

KEGG orthology group: None (inferred from 68% identity to eba:ebA6101)

MetaCyc: 49% identical to methyl parathion hydrolase (Cupriavidus sp. DT-1)
Aryldialkylphosphatase. [EC: 3.1.8.1]; 3.1.8.1 [EC: 3.1.8.1]

Predicted SEED Role

"Beta-lactamase-like"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.8.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL52 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dsui_2349 Zn-dependent hydrolase, glyoxylase (Dechlorosoma suillum PS)
MQLRRSLLALSAALLFLSPLARAEAPQVQTQVPGYYRTQLGDFEVTALYDGAIELETKLL
KNARPQDLNALLARMFVGNPKMQTAVNAYLINTGKNLVLVDTGAAKLFGPSLGNIAANLK
AAGYSLEQVDTVVLTHLHADHMGGLNDAGGQPIFPKARILAAQEDNDFWLSEKVAAAAPE
GMQPFFKLSRDSAAPYLAKGQWATFAAGSELVPGIQAVKANGHTPGHTAFAVESKGQKLL
IWGDLVHAHAVQFAKPGVSIEFDVDQKQAIATRKAIMKEAAASKVLVGGMHLPFPGLGHV
RAEGKGSYAWVPVEFAPLPARP