Protein Info for Dsui_2331 in Dechlorosoma suillum PS

Annotation: heat shock protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF04170: NlpE" amino acids 45 to 131 (87 residues), 56.5 bits, see alignment E=4.2e-19 PF03724: META" amino acids 269 to 376 (108 residues), 94.2 bits, see alignment E=5e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL35 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Dsui_2331 heat shock protein (Dechlorosoma suillum PS)
MGHPSKPAVPTSCRPFQPLRLVLLGLGLGWGLAAQAAPPALPATYIGEMPCANCVGVDWQ
LDLEADHSFQLSQAYRGKGVTAAVRRNGRWSLDAKGDVLTLEAPGSDSTRLSVQNPERLR
LLDGESRSIASRHNYELVRLPQALPARVSGTLTGLYSRQGKEGSIRLCAPGSPQFPVAAE
AAYGVLESAAGKLGREVGEAQLVRFAGHLASRRDGQVKVVVDRFYGVWPQAGCPGSDAVA
AARPAASPATAKAGAGGTASPAAASAPLPLVGTTWRLVQLDGKPLSRHRGNLAPHLLLQA
DGRVSGAGGCNRILGSYELKGQRIGFSQMGGTLMACMHHMDEEQAFLNALGWAQSWQISD
RHLLLRDGDGKAIAVFQAGSVGK