Protein Info for Dsui_2318 in Dechlorosoma suillum PS

Annotation: septum formation initiator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF04977: DivIC" amino acids 11 to 90 (80 residues), 85.6 bits, see alignment E=8.1e-29

Best Hits

Swiss-Prot: 82% identical to FTSB_DECAR: Cell division protein FtsB (ftsB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K05589, cell division protein FtsB (inferred from 82% identity to dar:Daro_2363)

Predicted SEED Role

"Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL22 at UniProt or InterPro

Protein Sequence (112 amino acids)

>Dsui_2318 septum formation initiator (Dechlorosoma suillum PS)
MRWLTIGLIALITLLQYPLWLGKGGWLKVWDVDRQLQQQKDANRKLEVRNGGLDAEVRDL
KQGYDAIEERARFELGMIKGDEVFVQLPEKAPERPAEPAPEVPPAKKARASR